PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26044.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 421aa    MW: 46804.7 Da    PI: 8.8472
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26044.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.2e-172067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT++Ed++l   ++q+G g+W++ +++ g+ R++k+c++rw +yl
  mrna26044.1-v1.0-hybrid 20 RGPWTPQEDKKLFAFIQQHGHGSWRSLPEKAGLQRCGKSCRLRWKNYL 67
                             89********************************************97 PP

2Myb_DNA-binding51.13.1e-1673118148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ +Ed+ +++++++lG++ W++Ia+ ++ +Rt++++k++w+++l
  mrna26044.1-v1.0-hybrid  73 RGNFSLQEDQTIIQLHALLGNR-WSAIAANLP-RRTDNEIKNYWNTHL 118
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8341567IPR017930Myb domain
SuperFamilySSF466893.56E-2917114IPR009057Homeodomain-like
SMARTSM007172.3E-131969IPR001005SANT/Myb domain
PfamPF002491.1E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-232174IPR009057Homeodomain-like
CDDcd001671.94E-102267No hitNo description
PROSITE profilePS5129425.71668122IPR017930Myb domain
SMARTSM007172.5E-1672120IPR001005SANT/Myb domain
PfamPF002492.4E-1573118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-2675122IPR009057Homeodomain-like
CDDcd001676.48E-1175118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEKSRTSTNS SSAATSNIKR GPWTPQEDKK LFAFIQQHGH GSWRSLPEKA GLQRCGKSCR  60
LRWKNYLRPD IKRGNFSLQE DQTIIQLHAL LGNRWSAIAA NLPRRTDNEI KNYWNTHLKK  120
RLDKIGFDPV THKPKTTILG FANGDPKNLS NLSHIAQWES ARLQAEARFV RESKLLKPAP  180
PPPPAQCLDF NLRTWETLMM SKSLTAGYGG GGEAGGVGRA TDVGSFVNFD GVPGNDGRLF  240
DVPPLTMSAA PDFSDVSEES GVREYGDILD ALLQQTYNNT GFDVADAWAW EQCDDISADC  300
QNSGSEEDVR TPLKCGRPSV WHRTAPTTAR LHPSGLQQRP RLLSFPGESV LFQFFGEITQ  360
NLISPENWNS ADSPGKESNR GRCWRPLGWR RVVVGAVRCQ TEGCPHFKGC ADVLFRTQLI  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26171234109B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301141.10.0PREDICTED: transcription factor MYB32-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.14e-86myb domain protein 106